Description

LL-37 (5mg)

LL-37 (5mg) is a research-grade synthetic antimicrobial peptide manufactured exclusively for laboratory and scientific research applications. Supplied as a 5mg lyophilized powder, LL-37 is intended for peptide chemistry, molecular biology, microbiology, immunology, biotechnology, and other controlled laboratory investigations.

LL-37 is the only known human cathelicidin antimicrobial peptide, consisting of 37 amino acids beginning with two leucine (L) residues, from which its name is derived. It is widely utilized in laboratory studies involving innate immunity, peptide-membrane interactions, cellular biology, and host defense mechanisms.

At Vial Peptides Labs, every research peptide is manufactured using standardized laboratory procedures and undergoes comprehensive analytical testing to help verify peptide identity, purity, and batch consistency. Every vial is clearly labeled For Research Use Only – Not for Human Use and is supplied exclusively for scientific research.

---

Product Specifications

• Product Name: LL-37
• Strength: 5mg
• Peptide Type: Synthetic Cathelicidin Antimicrobial Peptide
• Grade: Research Grade
• Appearance: White to off-white lyophilized powder
• Purity: High Purity
• Manufacturer: Vial Peptides Labs
• Website: https://vialpeptideslabs.com/

---

Peptide Structure

• Peptide Type: Synthetic Antimicrobial Peptide
• Sequence Length: 37 Amino Acids
• Amino Acid Sequence: [LL-37, 37 aa]
• Peptide Family: Human Cathelicidin (hCAP-18 Derived)
• Molecular Formula: Sequence-dependent peptide compound
• Molecular Weight: Approximately 4,493 Da (4.49 kDa)

---

Analytical Testing

Every production batch may undergo comprehensive laboratory evaluation, including:

• Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC)
• Mass Spectrometry (MS)
• Molecular Identity Verification
• Purity Assessment
• Batch Documentation
• Quality Control Review

These analytical procedures help support manufacturing consistency and accurate peptide characterization.

---

Manufacturing Standards

Vial Peptides Labs follows standardized laboratory manufacturing procedures designed to produce premium research-grade peptides.

Our manufacturing process includes:

• Verified raw materials
• Controlled peptide synthesis
• Advanced purification technologies
• Batch traceability
• Comprehensive quality control
• Technical documentation for every production batch

---

Storage Recommendations

For optimal product stability:

• Store refrigerated between 2°C and 8°C.
• Protect from moisture, direct sunlight, and excessive heat.
• Keep the vial tightly sealed until laboratory use.
• Follow appropriate laboratory handling procedures.

---

Packaging

Each LL-37 vial is professionally packaged to preserve product integrity during storage and transportation.

Packaging includes:

• Premium laboratory glass vial
• Secure aluminum seal and stopper
• Professional Vial Peptides Labs label
• Batch identification
• Protective shipping materials

---

Research Use Only

LL-37 (5mg) is supplied strictly for laboratory research purposes only.

Not for human consumption, therapeutic use, clinical application, diagnostic use, or veterinary use.

---

Why Choose Vial Peptides Labs?

Researchers choose Vial Peptides Labs because of our commitment to quality, consistency, and scientific excellence.

We provide:

• Premium research-grade peptides
• High-purity peptide products
• Advanced analytical testing
• Standardized manufacturing procedures
• Batch-specific quality control
• Secure worldwide shipping
• Professional customer support
• Continuously expanding catalog of laboratory research peptides

---

Related Products

• KPV (4mg)
• BPC-157 (10mg)
• TB-500 (10mg)
• GHK-Cu (50mg)
• GHK-Cu (200mg)
• Epithalon (25mg)
• Humanin (10mg)
• DSIP (5mg)